IP Address 23.155.76.202
Free IP lookup to check an IP address and search information like country, city, ISP, Proxy data and more.
IP Lookup Result
Geolocation Data
The geolocation data uses IP2Location DB26 geolocation database.
| 23.155.76.202 | |
| United States of America [US] | |
| Michigan | |
| Kalamazoo | |
| 42.291710, -85.587230 (42°17'30"N 85°35'14"W) | |
| Keshia Services Inc. | |
| 17 Apr, 2026 02:08 AM (UTC -04:00) | |
| keshiaservicesfinancialsystem.net | |
| (DSL) Broadband/Cable/Fiber/Mobile | |
| (1) 269 | |
| 49001 | |
| Kalamazoo (USMI0442) | |
| - | |
| - | |
| - | |
| 239m | |
| (COM) Commercial | |
| (U) Unicast | |
| (IAB24) Uncategorized | |
| Kalamazoo County | |
| AS401880 Keshia Services Inc. | |
| - | |
| 23.155.76.0/24 | |
| - | |
| America/Detroit |
Proxy Data
The proxy data uses IP2Proxy PX12 proxy database.
| IP Address | 23.155.76.202 |
|---|---|
| Anonymous Proxy | No |
| Proxy Country | - |
| Proxy Region | - |
| Proxy City | - |
| Proxy ISP | - |
| Proxy Domain | - |
| Proxy Usage Type | - |
| Proxy Type | - |
| Proxy ASN | - |
| Threat | - |
| Last Seen | - |
| Provider | - |
| Fraud Score | 0 |
IP2Location.io IP Geolocation API
Lookup an IP address to retrieve geolocation information
Try It NowGet
$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=23.155.76.202&format=json"
Response
{
"ip": "23.155.76.202",
"country_code": "US",
"country_name": "United States of America",
"region_name": "Michigan",
"district": "Kalamazoo County",
"city_name": "Kalamazoo",
"latitude": 42.29171,
"longitude": -85.58723,
"zip_code": "49001",
"time_zone": "-04:00",
"asn": "401880",
"as": "Keshia Services Inc.",
"as_info": {
"as_number": "401880",
"as_name": "Keshia Services Inc.",
"as_domain": "-",
"as_usage_type": "-",
"as_cidr": "23.155.76.0\/24"
},
"isp": "Keshia Services Inc.",
"domain": "keshiaservicesfinancialsystem.net",
"net_speed": "DSL",
"idd_code": "1",
"area_code": "269",
"weather_station_code": "USMI0442",
"weather_station_name": "Kalamazoo",
"mcc": "-",
"mnc": "-",
"mobile_brand": "-",
"elevation": 239,
"usage_type": "COM",
"address_type": "Unicast",
"ads_category": "IAB24",
"ads_category_name": "Uncategorized",
"continent": {
"name": "North America",
"code": "NA",
"hemisphere": [
"north",
"west"
],
"translation": {
"lang": null,
"value": null
}
},
"country": {
"name": "United States of America",
"alpha3_code": "USA",
"numeric_code": 840,
"demonym": "Americans",
"flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
"capital": "Washington, D.C.",
"total_area": 9826675,
"population": 339665118,
"currency": {
"code": "USD",
"name": "United States Dollar",
"symbol": "$"
},
"language": {
"code": "EN",
"name": "English"
},
"tld": "us",
"translation": {
"lang": null,
"value": null
}
},
"region": {
"name": "Michigan",
"code": "US-MI",
"translation": {
"lang": null,
"value": null
}
},
"city": {
"name": "Kalamazoo",
"translation": {
"lang": null,
"value": null
}
},
"time_zone_info": {
"olson": "America\/Detroit",
"current_time": "2026-04-17T02:08:23-04:00",
"gmt_offset": -14400,
"is_dst": true,
"abbreviation": "EDT",
"dst_start_date": "2026-03-08",
"dst_end_date": "2026-11-01",
"sunrise": "06:56",
"sunset": "20:27"
},
"geotargeting": {
"metro": "563"
},
"is_proxy": false,
"fraud_score": 0,
"proxy": {
"last_seen": 0,
"proxy_type": "-",
"threat": "-",
"provider": "-",
"is_vpn": false,
"is_tor": false,
"is_data_center": false,
"is_public_proxy": false,
"is_web_proxy": false,
"is_web_crawler": false,
"is_ai_crawler": false,
"is_residential_proxy": false,
"is_consumer_privacy_network": false,
"is_enterprise_private_network": false,
"is_spammer": false,
"is_scanner": false,
"is_botnet": false,
"is_bogon": false
}
}
Upload IP addresses in a file? Sign up IP2Location Bulk Service
Get Your IP Address Fast via Command Line
Copy and paste the command below into your terminal to retrieve your IP.
curl ip2location.io/ip
Power Your Work With Free IP Resources
Sign up a free account to unlock more benefits.
Get Free Account Now