IP Address

$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=2602:f5b3:40::&format=json"

{
    "ip": "2602:f5b3:0040:0000:0000:0000:0000:0000",
    "country_code": "US",
    "country_name": "United States of America",
    "region_name": "Michigan",
    "district": "Eaton County",
    "city_name": "Dimondale",
    "latitude": 42.64559,
    "longitude": -84.64887,
    "zip_code": "48821",
    "time_zone": "-04:00",
    "asn": "401880",
    "as": "Keshia Services Inc.",
    "as_info": {
        "as_number": "401880",
        "as_name": "Keshia Services Inc.",
        "as_domain": "keshiaservicesfinancialsystem.net",
        "as_usage_type": "-",
        "as_cidr": "2602:f5b3:40::\/42"
    },
    "isp": "Private Customer",
    "domain": "in-addr.arpa",
    "net_speed": "T1",
    "idd_code": "1",
    "area_code": "517",
    "weather_station_code": "USMI0233",
    "weather_station_name": "Dimondale",
    "mcc": "-",
    "mnc": "-",
    "mobile_brand": "-",
    "elevation": 261,
    "usage_type": "DCH",
    "address_type": "Unicast",
    "ads_category": "IAB19-11",
    "ads_category_name": "Data Centers",
    "continent": {
        "name": "North America",
        "code": "NA",
        "hemisphere": [
            "north",
            "west"
        ],
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "country": {
        "name": "United States of America",
        "alpha3_code": "USA",
        "numeric_code": 840,
        "demonym": "Americans",
        "flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
        "capital": "Washington, D.C.",
        "total_area": 9826675,
        "population": 339665118,
        "currency": {
            "code": "USD",
            "name": "United States Dollar",
            "symbol": "$"
        },
        "language": {
            "code": "EN",
            "name": "English"
        },
        "tld": "us",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "region": {
        "name": "Michigan",
        "code": "US-MI",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "city": {
        "name": "Dimondale",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "time_zone_info": {
        "olson": "America\/Detroit",
        "current_time": "2026-04-16T04:57:10-04:00",
        "gmt_offset": -14400,
        "is_dst": true,
        "abbreviation": "EDT",
        "dst_start_date": "2026-03-08",
        "dst_end_date": "2026-11-01",
        "sunrise": "06:53",
        "sunset": "20:23"
    },
    "geotargeting": {
        "metro": "551"
    },
    "is_proxy": false,
    "fraud_score": 3,
    "proxy": {
        "last_seen": 1,
        "proxy_type": "DCH",
        "threat": "-",
        "provider": "-",
        "is_vpn": false,
        "is_tor": false,
        "is_data_center": true,
        "is_public_proxy": false,
        "is_web_proxy": false,
        "is_web_crawler": false,
        "is_ai_crawler": false,
        "is_residential_proxy": false,
        "is_consumer_privacy_network": false,
        "is_enterprise_private_network": false,
        "is_spammer": false,
        "is_scanner": false,
        "is_botnet": false,
        "is_bogon": false
    }
}