IP Address

Free IP lookup to check an IP address and search information like country, city, ISP, Proxy data and more.

IP Lookup Result

Geolocation Data

The geolocation data uses IP2Location DB26 geolocation database.

https://www.ip2location.com/2602:f5b3:1::   
2602:f5b3:1::
United States of America [US]
New York
New York City
40.713190, -74.006070 (40°42'47"N   74°0'22"W)
Keshia Services Inc.
07 Apr, 2026 12:48 AM (UTC -04:00)
keshiaservicesfinancialsystems.net
(DSL) Broadband/Cable/Fiber/Mobile
(1) 212/646/718/917
10001
New York (USNY0996)
-
-
-
1m
(COM) Commercial
(U) Unicast
(IAB24) Uncategorized
New York County
AS29802 Hivelocity Inc.
hivelocity.net
2602:f5b3:1::/48
(DCH) Data Center/Web Hosting/Transit
America/New_York

Proxy Data

The proxy data uses IP2Proxy PX12 proxy database.

  
  IP Address 2602:f5b3:1::
  Anonymous Proxy No
  Proxy Country -
  Proxy Region -
  Proxy City -
  Proxy ISP -
  Proxy Domain -
  Proxy Usage Type -
  Proxy Type -
  Proxy ASN -
  Threat -
  Last Seen -
  Provider -
  Fraud Score 0

IP2Location.io IP Geolocation API

Lookup an IP address to retrieve geolocation information

Try It Now

Get

$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=2602:f5b3:1::&format=json"

Response

{
    "ip": "2602:f5b3:0001:0000:0000:0000:0000:0000",
    "country_code": "US",
    "country_name": "United States of America",
    "region_name": "New York",
    "district": "New York County",
    "city_name": "New York City",
    "latitude": 40.71319,
    "longitude": -74.00607,
    "zip_code": "10001",
    "time_zone": "-04:00",
    "asn": "29802",
    "as": "Hivelocity Inc.",
    "as_info": {
        "as_number": "29802",
        "as_name": "Hivelocity Inc.",
        "as_domain": "hivelocity.net",
        "as_usage_type": "DCH",
        "as_cidr": "2602:f5b3:1::\/48"
    },
    "isp": "Keshia Services Inc.",
    "domain": "keshiaservicesfinancialsystems.net",
    "net_speed": "DSL",
    "idd_code": "1",
    "area_code": "212\/646\/718\/917",
    "weather_station_code": "USNY0996",
    "weather_station_name": "New York",
    "mcc": "-",
    "mnc": "-",
    "mobile_brand": "-",
    "elevation": 1,
    "usage_type": "COM",
    "address_type": "Unicast",
    "ads_category": "IAB24",
    "ads_category_name": "Uncategorized",
    "continent": {
        "name": "North America",
        "code": "NA",
        "hemisphere": [
            "north",
            "west"
        ],
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "country": {
        "name": "United States of America",
        "alpha3_code": "USA",
        "numeric_code": 840,
        "demonym": "Americans",
        "flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
        "capital": "Washington, D.C.",
        "total_area": 9826675,
        "population": 339665118,
        "currency": {
            "code": "USD",
            "name": "United States Dollar",
            "symbol": "$"
        },
        "language": {
            "code": "EN",
            "name": "English"
        },
        "tld": "us",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "region": {
        "name": "New York",
        "code": "US-NY",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "city": {
        "name": "New York City",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "time_zone_info": {
        "olson": "America\/New_York",
        "current_time": "2026-04-07T00:48:18-04:00",
        "gmt_offset": -14400,
        "is_dst": true,
        "abbreviation": "EDT",
        "dst_start_date": "2026-03-08",
        "dst_end_date": "2026-11-01",
        "sunrise": "06:27",
        "sunset": "19:28"
    },
    "geotargeting": {
        "metro": "501"
    },
    "is_proxy": false,
    "fraud_score": 0,
    "proxy": {
        "last_seen": 0,
        "proxy_type": "-",
        "threat": "-",
        "provider": "-",
        "is_vpn": false,
        "is_tor": false,
        "is_data_center": false,
        "is_public_proxy": false,
        "is_web_proxy": false,
        "is_web_crawler": false,
        "is_ai_crawler": false,
        "is_residential_proxy": false,
        "is_consumer_privacy_network": false,
        "is_enterprise_private_network": false,
        "is_spammer": false,
        "is_scanner": false,
        "is_botnet": false,
        "is_bogon": false
    }
}

Upload IP addresses in a file? Sign up IP2Location Bulk Service

Check IP via Command Line

Get Your IP Address Fast via Command Line

Copy and paste the command below into your terminal to retrieve your IP.

curl ip2location.io/ip

Power Your Work With Free IP Resources

Sign up a free account to unlock more benefits.

Get Free Account Now

   Unlock free databases like country databases, country flags and more.

   Access free tools like traceroute, email tracer and more.

   Stay informed with monthly newsletters.