IP Address

Free IP lookup to check an IP address and search information like country, city, ISP, Proxy data and more.

IP Lookup Result

Geolocation Data

The geolocation data uses IP2Location DB26 geolocation database.

https://www.ip2location.com/2602:f5b3:1::   
2602:f5b3:1::
United States of America [US]
Michigan
Kalamazoo
42.291710, -85.587230 (42°17'30"N   85°35'14"W)
Keshia Services Inc.
03 Feb, 2026 08:03 PM (UTC -05:00)
keshiaservicesfinancialsystems.net
(T1) Data Center/Transit
(1) 269
49007
Kalamazoo (USMI0442)
-
-
-
238m
(DCH) Data Center/Web Hosting/Transit
(U) Unicast
(IAB19-11) Data Centers
Kalamazoo County
AS29802 Hivelocity Inc.
hivelocity.net
2602:f5b3:1::/48
(DCH) Data Center/Web Hosting/Transit
America/Detroit

Proxy Data

The proxy data uses IP2Proxy PX12 proxy database.

  
  IP Address 2602:f5b3:1::
  Anonymous Proxy No
  Proxy Country United States of America [US]
  Proxy Region Michigan
  Proxy City Kalamazoo
  Proxy ISP Keshia Services Inc.
  Proxy Domain keshiaservicesfinancialsystems.net
  Proxy Usage Type (DCH) Data Center/Web Hosting/Transit
  Proxy Type DCH
  Proxy ASN AS29802 Hivelocity Inc.
  Threat -
  Last Seen -
  Provider -
  Fraud Score 3

IP2Location.io IP Geolocation API

Lookup an IP address to retrieve geolocation information

Try It Now

Get

$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=2602:f5b3:1::&format=json"

Response

{
    "ip": "2602:f5b3:0001:0000:0000:0000:0000:0000",
    "country_code": "US",
    "country_name": "United States of America",
    "region_name": "Michigan",
    "district": "Kalamazoo County",
    "city_name": "Kalamazoo",
    "latitude": 42.29171,
    "longitude": -85.58723,
    "zip_code": "49007",
    "time_zone": "-05:00",
    "asn": "29802",
    "as": "Hivelocity Inc.",
    "as_info": {
        "as_number": "29802",
        "as_name": "Hivelocity Inc.",
        "as_domain": "hivelocity.net",
        "as_usage_type": "DCH",
        "as_cidr": "2602:f5b3:1::\/48"
    },
    "isp": "Keshia Services Inc.",
    "domain": "keshiaservicesfinancialsystems.net",
    "net_speed": "T1",
    "idd_code": "1",
    "area_code": "269",
    "weather_station_code": "USMI0442",
    "weather_station_name": "Kalamazoo",
    "mcc": "-",
    "mnc": "-",
    "mobile_brand": "-",
    "elevation": 238,
    "usage_type": "DCH",
    "address_type": "Unicast",
    "ads_category": "IAB19-11",
    "ads_category_name": "Data Centers",
    "continent": {
        "name": "North America",
        "code": "NA",
        "hemisphere": [
            "north",
            "west"
        ],
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "country": {
        "name": "United States of America",
        "alpha3_code": "USA",
        "numeric_code": 840,
        "demonym": "Americans",
        "flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
        "capital": "Washington, D.C.",
        "total_area": 9826675,
        "population": 339665118,
        "currency": {
            "code": "USD",
            "name": "United States Dollar",
            "symbol": "$"
        },
        "language": {
            "code": "EN",
            "name": "English"
        },
        "tld": "us",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "region": {
        "name": "Michigan",
        "code": "US-MI",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "city": {
        "name": "Kalamazoo",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "time_zone_info": {
        "olson": "America\/Detroit",
        "current_time": "2026-02-03T20:03:29-05:00",
        "gmt_offset": -18000,
        "is_dst": false,
        "abbreviation": "EST",
        "dst_start_date": "2026-03-08",
        "dst_end_date": "2026-11-01",
        "sunrise": "07:50",
        "sunset": "18:01"
    },
    "geotargeting": {
        "metro": "563"
    },
    "is_proxy": false,
    "fraud_score": 3,
    "proxy": {
        "last_seen": 1,
        "proxy_type": "DCH",
        "threat": "-",
        "provider": "-",
        "is_vpn": false,
        "is_tor": false,
        "is_data_center": true,
        "is_public_proxy": false,
        "is_web_proxy": false,
        "is_web_crawler": false,
        "is_residential_proxy": false,
        "is_consumer_privacy_network": false,
        "is_enterprise_private_network": false,
        "is_spammer": false,
        "is_scanner": false,
        "is_botnet": false,
        "is_bogon": false
    }
}

Upload IP addresses in a file? Sign up IP2Location Bulk Service

Check IP via Command Line

Get Your IP Address Fast via Command Line

Copy and paste the command below into your terminal to retrieve your IP.

curl ip2location.io/ip

Power Your Work With Free IP Resources

Sign up a free account to unlock more benefits.

Get Free Account Now

   Unlock free databases like country databases, country flags and more.

   Access free tools like traceroute, email tracer and more.

   Stay informed with monthly newsletters.