IP Address

Free IP lookup to check an IP address and search information like country, city, ISP, Proxy data and more.

IP2Location Free Demo Account

Tap into Geolocation Excellence: Get Your Free IP2Location Demo Account Today!

  •  200 daily IP address queries
  •  Support IP addresses in IPv4 & IPv6
  •  Stay up-to-date with daily database updates
Sign Up For Free

IP Lookup Result

Geolocation Data

The geolocation data uses IP2Location DB26 geolocation database.

https://www.ip2location.com/2602:f5b3:1::   
2602:f5b3:1::
United States of America [US]
Michigan
Kalamazoo
42.291710, -85.587230 (42°17'30"N   85°35'14"W)
Keshia Services Inc.
02 Jan, 2026 03:07 PM (UTC -05:00)
keshiaservicesfinancialsystems.net
(T1) Data Center/Transit
(1) 269
49007
Kalamazoo (USMI0442)
-
-
-
238m
(DCH) Data Center/Web Hosting/Transit
(U) Unicast
(IAB19-11) Data Centers
Kalamazoo County
AS29802 Hivelocity Inc.
hivelocity.net
2602:f5b3:1::/48
(DCH) Data Center/Web Hosting/Transit
America/Detroit

Proxy Data

The proxy data uses IP2Proxy PX12 proxy database.

  
  IP Address 2602:f5b3:1::
  Anonymous Proxy No
  Proxy Country United States of America [US]
  Proxy Region Michigan
  Proxy City Kalamazoo
  Proxy ISP Keshia Services Inc.
  Proxy Domain keshiaservicesfinancialsystems.net
  Proxy Usage Type (DCH) Data Center/Web Hosting/Transit
  Proxy Type DCH
  Proxy ASN AS29802 Hivelocity Inc.
  Threat -
  Last Seen -
  Provider -
  Fraud Score 3

Bots

You can easily lookup an IP address on the below channels using the below commands.

Slack Bot

IP2Location Slack Bot /ip2location 2602:f5b3:1::
IP2Proxy Slack Bot /ip2proxy 2602:f5b3:1::

Reddit Bot

IP2Location Reddit Bot u/ip2location_bot 2602:f5b3:1::
IP2Proxy Reddit Bot u/ip2proxy_bot 2602:f5b3:1::

Telegram Bot

IP2Location Telegram Bot ip2location 2602:f5b3:1::
IP2Proxy Telegram Bot ip2proxy 2602:f5b3:1::

IP Address Notification

Would you like to receive an email notification if the results for the IP address 2602:f5b3:1:: change? Sign up for notification here.

Sign Up Now to Get 200 Daily IP Lookups

Sign Up For Free Now

IP2Location.io IP Geolocation API

Lookup an IP address to retrieve geolocation information

Try It Now

Get

$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=2602:f5b3:1::&format=json"

Response

{
    "ip": "2602:f5b3:0001:0000:0000:0000:0000:0000",
    "country_code": "US",
    "country_name": "United States of America",
    "region_name": "Michigan",
    "district": "Kalamazoo County",
    "city_name": "Kalamazoo",
    "latitude": 42.29171,
    "longitude": -85.58723,
    "zip_code": "49007",
    "time_zone": "-05:00",
    "asn": "29802",
    "as": "Hivelocity Inc.",
    "as_info": {
        "as_number": "29802",
        "as_name": "Hivelocity Inc.",
        "as_domain": "hivelocity.net",
        "as_usage_type": "DCH",
        "as_cidr": "2602:f5b3:1::\/48"
    },
    "isp": "Keshia Services Inc.",
    "domain": "keshiaservicesfinancialsystems.net",
    "net_speed": "T1",
    "idd_code": "1",
    "area_code": "269",
    "weather_station_code": "USMI0442",
    "weather_station_name": "Kalamazoo",
    "mcc": "-",
    "mnc": "-",
    "mobile_brand": "-",
    "elevation": 238,
    "usage_type": "DCH",
    "address_type": "Unicast",
    "ads_category": "IAB19-11",
    "ads_category_name": "Data Centers",
    "continent": {
        "name": "North America",
        "code": "NA",
        "hemisphere": [
            "north",
            "west"
        ],
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "country": {
        "name": "United States of America",
        "alpha3_code": "USA",
        "numeric_code": 840,
        "demonym": "Americans",
        "flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
        "capital": "Washington, D.C.",
        "total_area": 9826675,
        "population": 339665118,
        "currency": {
            "code": "USD",
            "name": "United States Dollar",
            "symbol": "$"
        },
        "language": {
            "code": "EN",
            "name": "English"
        },
        "tld": "us",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "region": {
        "name": "Michigan",
        "code": "US-MI",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "city": {
        "name": "Kalamazoo",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "time_zone_info": {
        "olson": "America\/Detroit",
        "current_time": "2026-01-02T15:07:30-05:00",
        "gmt_offset": -18000,
        "is_dst": false,
        "abbreviation": "EST",
        "dst_start_date": "2025-03-09",
        "dst_end_date": "2025-11-02",
        "sunrise": "08:09",
        "sunset": "17:23"
    },
    "geotargeting": {
        "metro": "563"
    },
    "is_proxy": false,
    "fraud_score": 3,
    "proxy": {
        "last_seen": 1,
        "proxy_type": "DCH",
        "threat": "-",
        "provider": "-",
        "is_vpn": false,
        "is_tor": false,
        "is_data_center": true,
        "is_public_proxy": false,
        "is_web_proxy": false,
        "is_web_crawler": false,
        "is_residential_proxy": false,
        "is_consumer_privacy_network": false,
        "is_enterprise_private_network": false,
        "is_spammer": false,
        "is_scanner": false,
        "is_botnet": false,
        "is_bogon": false
    }
}

Upload IP addresses in a file? Sign up IP2Location Bulk Service

More Benefits,
More IP Queries Daily

Sign up a free demo account to unlock more benefits.

Get Free Account Now

    Supports up to 200 IP address queries per day.

    Support IP addresses in IPv4 and IPv6.

    Stay informed with monthly newsletters.