IP Address
Free IP lookup to check an IP address and search information like country, city, ISP, Proxy data and more.
Tap into Geolocation Excellence: Get Your Free IP2Location Demo Account Today!
- 200 daily IP address queries
- Support IP addresses in IPv4 & IPv6
- Stay up-to-date with daily database updates
IP Lookup Result
Geolocation Data
The geolocation data uses IP2Location DB26 geolocation database.
| 2602:f5b3:1:: | |
| United States of America [US] | |
| Michigan | |
| Kalamazoo | |
| 42.291710, -85.587230 (42°17'30"N 85°35'14"W) | |
| Keshia Services Inc. | |
| 02 Jan, 2026 03:07 PM (UTC -05:00) | |
| keshiaservicesfinancialsystems.net | |
| (T1) Data Center/Transit | |
| (1) 269 | |
| 49007 | |
| Kalamazoo (USMI0442) | |
| - | |
| - | |
| - | |
| 238m | |
| (DCH) Data Center/Web Hosting/Transit | |
| (U) Unicast | |
| (IAB19-11) Data Centers | |
| Kalamazoo County | |
| AS29802 Hivelocity Inc. | |
| hivelocity.net | |
| 2602:f5b3:1::/48 | |
| (DCH) Data Center/Web Hosting/Transit | |
| America/Detroit |
Proxy Data
The proxy data uses IP2Proxy PX12 proxy database.
| IP Address | 2602:f5b3:1:: |
|---|---|
| Anonymous Proxy | No |
| Proxy Country | United States of America [US] |
| Proxy Region | Michigan |
| Proxy City | Kalamazoo |
| Proxy ISP | Keshia Services Inc. |
| Proxy Domain | keshiaservicesfinancialsystems.net |
| Proxy Usage Type | (DCH) Data Center/Web Hosting/Transit |
| Proxy Type | DCH |
| Proxy ASN | AS29802 Hivelocity Inc. |
| Threat | - |
| Last Seen | - |
| Provider | - |
| Fraud Score | 3 |
Bots
You can easily lookup an IP address on the below channels using the below commands.
Slack Bot
| IP2Location Slack Bot | /ip2location 2602:f5b3:1:: |
|---|---|
| IP2Proxy Slack Bot | /ip2proxy 2602:f5b3:1:: |
Reddit Bot
| IP2Location Reddit Bot | u/ip2location_bot 2602:f5b3:1:: |
|---|---|
| IP2Proxy Reddit Bot | u/ip2proxy_bot 2602:f5b3:1:: |
Telegram Bot
| IP2Location Telegram Bot | ip2location 2602:f5b3:1:: |
|---|---|
| IP2Proxy Telegram Bot | ip2proxy 2602:f5b3:1:: |
IP Address Notification
Would you like to receive an email notification if the results for the IP address 2602:f5b3:1:: change? Sign up for notification here.
Sign Up Now to Get 200 Daily IP Lookups
Sign Up For Free NowIP2Location.io IP Geolocation API
Lookup an IP address to retrieve geolocation information
Try It NowGet
$ curl "https://api.ip2location.io?key={YOUR API KEY}&ip=2602:f5b3:1::&format=json"
Response
{
"ip": "2602:f5b3:0001:0000:0000:0000:0000:0000",
"country_code": "US",
"country_name": "United States of America",
"region_name": "Michigan",
"district": "Kalamazoo County",
"city_name": "Kalamazoo",
"latitude": 42.29171,
"longitude": -85.58723,
"zip_code": "49007",
"time_zone": "-05:00",
"asn": "29802",
"as": "Hivelocity Inc.",
"as_info": {
"as_number": "29802",
"as_name": "Hivelocity Inc.",
"as_domain": "hivelocity.net",
"as_usage_type": "DCH",
"as_cidr": "2602:f5b3:1::\/48"
},
"isp": "Keshia Services Inc.",
"domain": "keshiaservicesfinancialsystems.net",
"net_speed": "T1",
"idd_code": "1",
"area_code": "269",
"weather_station_code": "USMI0442",
"weather_station_name": "Kalamazoo",
"mcc": "-",
"mnc": "-",
"mobile_brand": "-",
"elevation": 238,
"usage_type": "DCH",
"address_type": "Unicast",
"ads_category": "IAB19-11",
"ads_category_name": "Data Centers",
"continent": {
"name": "North America",
"code": "NA",
"hemisphere": [
"north",
"west"
],
"translation": {
"lang": null,
"value": null
}
},
"country": {
"name": "United States of America",
"alpha3_code": "USA",
"numeric_code": 840,
"demonym": "Americans",
"flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
"capital": "Washington, D.C.",
"total_area": 9826675,
"population": 339665118,
"currency": {
"code": "USD",
"name": "United States Dollar",
"symbol": "$"
},
"language": {
"code": "EN",
"name": "English"
},
"tld": "us",
"translation": {
"lang": null,
"value": null
}
},
"region": {
"name": "Michigan",
"code": "US-MI",
"translation": {
"lang": null,
"value": null
}
},
"city": {
"name": "Kalamazoo",
"translation": {
"lang": null,
"value": null
}
},
"time_zone_info": {
"olson": "America\/Detroit",
"current_time": "2026-01-02T15:07:30-05:00",
"gmt_offset": -18000,
"is_dst": false,
"abbreviation": "EST",
"dst_start_date": "2025-03-09",
"dst_end_date": "2025-11-02",
"sunrise": "08:09",
"sunset": "17:23"
},
"geotargeting": {
"metro": "563"
},
"is_proxy": false,
"fraud_score": 3,
"proxy": {
"last_seen": 1,
"proxy_type": "DCH",
"threat": "-",
"provider": "-",
"is_vpn": false,
"is_tor": false,
"is_data_center": true,
"is_public_proxy": false,
"is_web_proxy": false,
"is_web_crawler": false,
"is_residential_proxy": false,
"is_consumer_privacy_network": false,
"is_enterprise_private_network": false,
"is_spammer": false,
"is_scanner": false,
"is_botnet": false,
"is_bogon": false
}
}
Upload IP addresses in a file? Sign up IP2Location Bulk Service
More Benefits,
More IP Queries Daily
Sign up a free demo account to unlock more benefits.
Get Free Account Now